RIAM Antibody

RIAM Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Catalog#: NBP2-14300
LID#: 171726A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID54518
Preservation0.02% Sodium Azide
Species ReactivityReacts in Human. Expected species cross reactivity based on sequence identity (not validated): Mouse (80%), Rat (81%)
Gene SymbolAPBB1IP
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFK DLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQ ASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPP
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage Buffer40% glycerol and PBS pH 7.2.
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:200-1:500
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymamyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, proline rich EVH1 ligand 1, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution