RHBDD3 Antibody

RHBDD3 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Catalog#: NBP1-92331
LID#: 171695A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID25807
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolRHBDD3
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:HWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSL
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPhospate buffered saline, pH 7.2, containing 40% glycerol
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:200-1:500
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymC22orf3, chromosome 22 open reading frame 3, HS984G1A, pituitary tumor apoptosis, PTAG, rhomboid domain containing 3, rhomboid domain-containing protein 3

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution