RGS7 Antibody

RGS7 Antibody

Product Information

Product Overview:

See detailed product specifications below.


This is a rabbit polyclonal antibody against Rgs7 and was validated on Western blot.

Catalog#: NBP1-80513
LID#: 171694A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Bovine
Entrez Human ID6000
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 92%
Gene SymbolRGS7
Species AbbreviationHu, Mu, Rt, Bv
Grade/PurityIgG purified
ImmunogenSynthetic peptide directed towards the N terminal of mouse Rgs7 . Peptide sequence MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:1000
Unit Size0.1 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymregulator of G-protein signaling 7, regulator of G-protein signaling RGS7, regulator of G-protein signalling 7

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals