RGS3 Antibody

RGS3 Antibody

Product Information

Product Overview:

RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known.


This is a rabbit polyclonal antibody against RGS3 and was validated on Western blot.

Catalog#: NBP1-58312
LID#: 171671A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit
ControlsFetal Heart
Entrez Human ID5998
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Chicken: 76%
Swissprot Human IDP49796-4
TMW101 kDa
Gene SymbolRGS3
Species AbbreviationHu, Mu, Rt, Bv, Ca, Eq, GP, Po, Rb
Grade/PurityPeptide affinity purified
ImmunogenSynthetic peptide directed towards the C terminal of human RGS3 Peptide sequence KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 0.2-1 ug/ml
Unit Size0.05 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymC2PA, FLJ31516, FLJ20370, FLJ90496, PDZ-RGS3, regulator of G-protein signaling 3, regulator of G-protein signalling 3, RGP3

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals