RGS3 Antibody

RGS3 Antibody

Product Information

Product Overview:

RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known.

Application:

This is a rabbit polyclonal antibody against RGS3 and was validated on Western blot.

Catalog#: NBP1-58312
LID#: 171671A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit
ControlsFetal Heart
Entrez Human ID5998
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Chicken: 76%
Swissprot Human IDP49796-4
TMW101 kDa
Gene SymbolRGS3
ApplicationsWB
Species AbbreviationHu, Mu, Rt, Bv, Ca, Eq, GP, Po, Rb
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenSynthetic peptide directed towards the C terminal of human RGS3 Peptide sequence KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 0.2-1 ug/ml
Unit Size0.05 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymC2PA, FLJ31516, FLJ20370, FLJ90496, PDZ-RGS3, regulator of G-protein signaling 3, regulator of G-protein signalling 3, RGP3

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals