RFX2 Antibody

RFX2 Antibody

Product Information

Product Overview:

See detailed product specifications below.


This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Catalog#: NBP2-13224
LID#: 171622A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID5990
Preservation0.02% Sodium Azide
Species ReactivityReacts in Human. Expected species cross reactivity based on sequence identity (not validated): Mouse (80%), Rat (36%)
Gene SymbolRFX2
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPN HSLQGI
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage Buffer40% glycerol and PBS pH 7.2.
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:50-1:200, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymDNA binding protein RFX2, DNA-binding protein RFX2, FLJ14226, HLA class II regulatory factor RFX2, Regulatory factor X 2, regulatory factor X, 2 (influences HLA class II expression), trans-acting regulatory factor 2

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals