RFPL4B Antibody

RFPL4B Antibody

Product Information

Product Overview:

RFPL4B contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of RFPL4B remains unknown.

Application:

This is a rabbit polyclonal antibody against RFPL4B and was validated on Western blot.

Catalog#: NBP1-55032
LID#: 171610A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID442247
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Human: 100%;
Swissprot Human IDQ6ZWI9
Gene SymbolRFPL4B
ApplicationsWB
Species AbbreviationHu
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenSynthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPA.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:100-1:2000
Gene ID5052
Unit Size0.05 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymret finger protein-like 4B, RNF211RING finger protein 211

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals