MRPL42 Antibody

MRPL42 Antibody

Product Information

Product Overview:

See detailed product specifications below.


For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

Catalog#: NBP1-83171
LID#: 171817A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID28977
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolMRPL42
ApplicationsWB, ICC/IF, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:YEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKD
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:10-1:20, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonym39S ribosomal protein L31, mitochondrial, 39S ribosomal protein L42, mitochondrial, HSPC204,28S ribosomal protein S32, mitochondrial, L31mt, mitochondrial ribosomal protein L42, mitochondrial ribosomal protein S32, MRPS32MRP-L42, MRPL31L42mt, MRP-L31MRP-S32, PTD007, RPML31S32mt

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals