MRPL38 Antibody

MRPL38 Antibody

Product Information

Product Overview:

See detailed product specifications below.


For IHC-Paraffin HIER pH6 retrieval is recommended.

Catalog#: NBP1-81673
LID#: 171816A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID64978
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolMRPL38
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:FHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAE
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:200-1:500, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymFLJ13996, HSPC262, KIAA1863, L38MT, L38mt, MGC4810, mitochondrial ribosomal protein L38,39S ribosomal protein L38, mitochondrial, MRP-L3, MRP-L38, RPML3

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution