MRPL17 Antibody

MRPL17 Antibody

Product Information

Product Overview:

See detailed product specifications below.


This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Catalog#: NBP2-13611
LID#: 171809A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID63875
Preservation0.02% Sodium Azide
Species ReactivityReacts in Human. Expected species cross reactivity based on sequence identity (not validated): Mouse (94%), Rat (95%)
Gene SymbolMRPL17
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: LSVAAAISHGRVFRRMGLGPESRIHLLRNLLTGLVRHERIEAPWARVDEM RGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLI
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage Buffer40% glycerol and PBS pH 7.2.
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:200-1:500, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymL17mt, LIP2, LYST-interacting protein LIP2, LYST-interacting protein 2, mitochondrial ribosomal protein L17, MRP-L17, MRP-L26, RPL17L, RPML26,39S ribosomal protein L17, mitochondrial

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals