MRPL13 Antibody

MRPL13 Antibody

Product Information

Product Overview:

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.

Application:

This is a rabbit polyclonal antibody against MRPL13 and was validated on Western blot.

Catalog#: NBP1-57600
LID#: 171808A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Canine, Guinea Pig, Porcine, Rabbit, Zebrafish
Entrez Human ID28998
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Canine: 92%; Rabbit: 92%; Zebrafish: 92%; Guinea pig: 78%
Swissprot Human IDQ9BYD1
Gene SymbolMRPL13
ApplicationsWB
Species AbbreviationHu, Mu, Rt, Ca, GP, Po, Rb, Ze
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenSynthetic peptides corresponding to MRPL13(mitochondrial ribosomal protein L13) The peptide sequence was selected from the middle region of MRPL13. Peptide sequence AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:100-1:2000
Unit Size0.05 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonym39S ribosomal protein L13, mitochondrial, L13, L13A, L13mtRPML13, mitochondrial ribosomal protein L13, MRP-L13, RPL13

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals