MPP7 Antibody

MPP7 Antibody

Product Information

Product Overview:

MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.Membrane-associated guanylate kinases (MAGUKs) are important adaptor proteins involved in the assembly of protein complexes at sites of cell-cell contact. They are found in synapses, adherens junctions, and tight junctions. All MAGUKs contain at least 1 PDZ domain, an SH3 domain, and a GUK domain, and many contain 1 or 2 L27 domains, which are involved in multimerization of MAGUKs. MPP7 belongs to the p55 stardust subfamily of MAGUKs, which is named for a Drosophila gene required for establishment of cell polarity in the developing fly embryo (Bohl et al., 2007 [PubMed 17237226]).[supplied by OMIM].


This is a rabbit polyclonal antibody against MPP7 and was validated on Western blot.

Catalog#: NBP1-53081
LID#: 171725A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Bovine, Equine
Entrez Human ID143098
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Swissprot Human IDQ5T2T1
Gene SymbolMPP7
Species AbbreviationHu, Mu, Rt, Bv, Eq
Grade/PurityPeptide affinity purified
ImmunogenSynthetic peptides corresponding to MPP7(membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)) The peptide sequence was selected from the N terminal of MPP7. Peptide sequence MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:100-1:2000
Gene ID284353
Unit Size0.05 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymFLJ32798, MAGUK p55 subfamily member 7, membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals