MECR Antibody

MECR Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

For IHC-Paraffin HIER pH6 retrieval is recommended.

Catalog#: NBP1-85659
LID#: 171766A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID51102
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolMECR
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:SDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCV
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:50-1:200, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymCGI-63, EC 1.3.1.38, FASN2B, homolog of yeast 2-enoyl thioester reductase, HsNrbf-1, mitochondrial 2-enoyl thioester reductase, mitochondrial trans-2-enoyl-CoA reductase, NBRF1, nuclear receptor binding factor 1, NRBF-1, NRBF1hsNrbf-1, Nuclear receptor-binding factor 1, trans-2-enoyl-CoA reductase, mitochondrial

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals