MDP1 Antibody

MDP1 Antibody

Product Information

Product Overview:

MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Application:

This is a rabbit polyclonal antibody against MDP-1 and was validated on Western blot.

Catalog#: NBP1-56573
LID#: 171703A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Bovine
Entrez Human ID145553
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Bovine: 100%
Swissprot Human IDQ86V88
Gene SymbolMDP1
ApplicationsWB
Species AbbreviationHu, Bv
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenSynthetic peptides corresponding to MDP-1 The peptide sequence was selected from the N terminal of MDP-1. Peptide sequence MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:100-1:2000
Gene ID5926
Unit Size0.05 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymEC 3.1.3.-, EC 3.1.3.48, fructosamine-6-phosphatase, FN6Pase, FN6PASE, magnesium-dependent phosphatase 1, MDP-1, MGC5987, S, SFTB3, SFTPB

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals