MDH2 Antibody

MDH2 Antibody

Product Information

Product Overview:

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Catalog#: NBP1-54649
LID#: 171677A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Bovine, Canine, Equine, Guinea Pig
Entrez Human ID4191
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Bovine: 92%; Chicken: 92%; Canine: 92%; Equine: 92%; Xenopus: 78%
Swissprot Human IDP40926
TMW36 kDa
Gene SymbolMDH2
Species AbbreviationHu, Bv, Ca, Eq, GP
Grade/PurityProtein A purified
ImmunogenSynthetic peptides corresponding to MDH2(malate dehydrogenase 2, NAD (mitochondrial)) The peptide sequence was selected from the C terminal of MDH2 (NP_005909). Peptide sequence TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK.
Storage BufferLyophilized from PBS & 2% Sucrose.
DilutionWestern Blot 2.5 ug/ml
Gene ID4982
Unit Size0.1 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymEC 1.1.1, EC, malate dehydrogenase 2, NAD (mitochondrial), MDH, MGC:3559, mitochondrial, MOR1

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution