MDGA1 Antibody

MDGA1 Antibody

Product Information

Product Overview:

See detailed product specifications below.


This antibody is useful in Immunohistochemistry-Paraffin; HIER pH6 retrieval is recommended.

Catalog#: NBP1-93712
LID#: 171665A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID266727
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolMDGA1
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:AHVPISPSGPFQIIFEGVRGPGYLGDIAIDDVTLKKGECPRKQTDPNKVVVMPGSGAPCQSSPQLWGPMAIFLLALQR
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPhospate buffered saline, pH 7.2, containing 40% glycerol
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:20-1:50
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymFLJ45018, MAM domain containing glycosylphosphatidylinositol anchor 1, MAMDC3

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals