MBTD1 Antibody

MBTD1 Antibody

Product Information

Product Overview:

See detailed product specifications below.


This is a rabbit polyclonal antibody against Mbtd1 and was validated on Western blot.

Catalog#: NBP1-91375
LID#: 171799A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Mouse, Bovine, Canine, Equine, Porcine, Rabbit
Entrez Human ID54799
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%
Gene SymbolMBTD1
Species AbbreviationHu, Mu, Bv, Ca, Eq, Po, Rb
Grade/PurityPeptide affinity purified
ImmunogenThe specific Immunogen is proprietary information. Peptide sequence LVPPRTVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRV.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:1000
Unit Size0.05 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymmbt domain containing 1

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals