MBNL3 Antibody

MBNL3 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

Catalog#: NBP1-85635
LID#: 171798A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID55796
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolMBNL3
ApplicationsICC/IF, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:AQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAAS
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionImmunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:50-1:200
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymCHCRMBLX39FLJ11316, Cys3His CCG1-required protein, FLJ97142, MBXLMBLX, muscleblind-like 3 (Drosophila), muscleblind-like protein 3, Muscleblind-like X-linked protein, Protein HCHCR

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution