MBD5 Antibody

MBD5 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

For IHC-P HIER pH6 retrieval is recommended.

Catalog#: NBP1-83775
LID#: 171797A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
ControlsHuman Liver Tissue (IHC-P)
Entrez Human ID55777
Preservation0.02% Sodium Azide
Species ReactivityHuman. Predicted cross-reactivity based on sequence identity: Mouse(92%), Rat(92%).
Swissprot Human IDQ9P267
Gene SymbolMBD5
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:LPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSST
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:50-1:200
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymKIAA1461, methyl-CpG binding domain protein 5, methyl-CpG-binding domain protein 5, methyl-CpG-binding protein MBD5, MRD1

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals