LOC729420 Antibody

LOC729420 Antibody

Product Information

Product Overview:

See detailed product specifications below.


This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Catalog#: NBP2-14754
LID#: 171800A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID729420
Preservation0.02% Sodium Azide
Species ReactivityReacts in Human. Expected species cross reactivity based on sequence identity (not validated): Mouse(28%), Rat(26%)
Gene SymbolC13orf45
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLE VRWWIKGKQGYVISLGHA
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage Buffer40% glycerol and PBS pH 7.2.
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymLOC729420 uncharacterized LOC729420

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals