LOC390338 Antibody

LOC390338 Antibody

Product Information

Product Overview:

See detailed product specifications below.


This is a rabbit polyclonal antibody against LOC390338 and was validated on Western blot.

Catalog#: NBP1-91527
LID#: 171789A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Bovine, Canine, Zebrafish
Entrez Human ID390338
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Xenopus: 85%; Mouse: 85%; Chicken: 85%; Human: 100%; Canine: 85%; Bovine: 85%; Rat: 85%; Western clawed frog: 85%; Zebrafish: 78%; Green puffer: 78%;
Gene SymbolLOC390338
Species AbbreviationHu, Mu, Rt, Bv, Ca, Ze
Grade/PurityPeptide affinity purified
ImmunogenSynthetic peptide directed towards the middle region of human LOC390338 . Peptide sequence RESVESLIQKHSNAPSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSL.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:1000
Unit Size0.05 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymLOC390338 similar to T-box 20 isoform a

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals