LOC100047915 Antibody

LOC100047915 Antibody

Product Information

Product Overview:

The function remains unknown.

Application:

This is a rabbit polyclonal antibody against LOC100047915 and was validated on Western blot.

Catalog#: NBP1-74243
LID#: 171788A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Mouse
Entrez Human ID100047915
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityThis product recognizes Mouse.
Gene SymbolLOC100047915
ApplicationsWB
Species AbbreviationHu, Mu
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenSynthetic peptides corresponding to the N terminal of LOC100047915. Immunizing peptide sequence SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1 ug/ml
Unit Size0.05 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymsimilar to Memo1 protein

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals