All
>
>
LMF1 Antibody

LMF1 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

For HIER pH6 retrieval is recommended.

Catalog#: NBP1-88442
LID#: 171699A
Quantity :
Request Quote Submit Support Ticket Generate Quote
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID64788
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolLMF1
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:HQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDL
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:20-1:50
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymchromosome 16 open reading frame 26, FLJ12681, FLJ22302, HMFN1876, JFP11, lipase maturation factor 1, TMEM112C16orf26, Transmembrane protein 112TMEM112A

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Write a Review
Review & Rating Distribution
Speak your mind and get rewarded.
LEARN MORE

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals