LIPM Antibody

LIPM Antibody

Product Information

Product Overview:

LIPM plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.

Catalog#: NBP1-98283
LID#: 171567A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Porcine
Entrez Human ID340654
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Human: 100%; Pig: 84%
Swissprot Human IDNP_001121687
Gene SymbolLIPM
ApplicationsWB, IB
Species AbbreviationHu, Po
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenThe immunogen for this antibody is LIPM - N-terminal region. Peptide sequence PCEEYEVATEDGYILSVNRIPRGLVQPKKTGSRPVVLLQHGLVGGASNWI.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionImmunoblotting 1:100-1:2000, Western Blot 1:1000
Unit Size0.05mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymlipase member M, bA304I5.1, LIPL3, lipase, family member M

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals