LINGO2 Antibody

LINGO2 Antibody

Product Information

Product Overview:

See detailed product specifications below.


For HIER pH6 retrieval is recommended.

Catalog#: NBP1-81311
LID#: 171524A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID158038
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolLINGO2
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:ITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMY
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:50-1:200
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymLERN3FLJ31810, leucine rich repeat and Ig domain containing 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C, leucine-rich repeat and immunoglobulin-like domain-containing nogoreceptor-interacting protein 2, LRRN6Cleucine rich repeat neuronal 6C

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution