LCN8 Antibody

LCN8 Antibody

Product Information

Product Overview:

See detailed product specifications below.


For HIER pH6 retrieval is recommended.

Catalog#: NBP1-82841
LID#: 171688A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
Entrez Human ID138307
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolLCN8
ApplicationsIHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:IGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYNSSGSCEIEKIVGSEIDSTG
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:50-1:200
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymchromosome 9 open reading frame 137, EP17, epididymal-specific lipocalin-8, LCN5, lipocalin 5, lipocalin 8

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution