LASS3 Antibody

LASS3 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

For IHC-Paraffin HIER pH6 retrieval is recommended.

Catalog#: NBP1-84535
LID#: 171549A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID204219
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolCERS3
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKEMDCLKNGLGAERHLIPNGQH
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPBS, pH 7.2, containing 40% glycerol
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:50-1:200, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymCerS3, LAG1 homolog, ceramide synthase 3, LAG1 longevity assurance homolog 3, LAG1 longevity assurance homolog 3 (S. cerevisiae), MGC27091

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals