LAS2 Antibody

LAS2 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

This is a rabbit polyclonal antibody against C18orf54 and was validated on Western blot.

Catalog#: NBP1-79525
LID#: 171548A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Canine, Guinea Pig
Entrez Human ID162681
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Canine: 92%; Guinea pig: 84%
Swissprot Human IDEAW63006.1
Gene SymbolC18ORF54
ApplicationsWB
Species AbbreviationHu, Ca, GP
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenSynthetic peptide directed towards the middle region of human C18orf54The immunogen for this antibody is C18ORF54. Peptide sequence PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:1000
Unit Size0.05 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymC18orf54, chromosome 18 open reading frame 54, hypothetical protein LOC162681, LAS2, MGC33382

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals