Indian Hedgehog Antibody

Indian Hedgehog Antibody

Product Information

Product Overview:

IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).

Application:

This is a rabbit polyclonal antibody against IHH and was validated on Western Blot and immunohistochemistry-paraffin

Catalog#: NBP1-59443
LID#: 171624A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Canine, Guinea Pig, Porcine, Zebrafish
Entrez Human ID3549
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Xenopus: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 92%
Swissprot Human IDQ14623
Gene SymbolIHH
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu, Mu, Rt, Ca, GP, Po, Ze
Grade/PurityIgG purified
ClonalityPolyclonal
ImmunogenSynthetic peptides corresponding to IHH(Indian hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of IHH. Peptide sequence AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:10-1:2000, Western Blot 1:100-1:2000
Unit Size0.1 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymBDA1Indian hedgehog homolog (Drosophila), HHG2, HHG-2, Indian hedgehog, Indian hedgehog (Drosophila) homolog, Indian hedgehog homolog, indian hedgehog protein

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals