IQCB1 Antibody

IQCB1 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Application:

This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Catalog#: NBP2-14126
LID#: 171698A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID9657
Preservation0.02% Sodium Azide
Species ReactivityReacts in Human. Expected species cross reactivity based on sequence identity (not validated): Mouse (86%), Rat (88%)
Gene SymbolIQCB1
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: AVTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRH LGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVE QLMK
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage Buffer40% glycerol and PBS pH 7.2.
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:500-1:1000, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymIQ calmodulin-binding motif containing 1, IQ motif containing B1, KIAA0036nephrocystin 5, Nephrocystin-5, NPHP5IQ calmodulin-binding motif-containing protein 1, p53 and DNA damage-regulated IQ motif protein, PIQ, SLSN5

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals