ING1 Antibody (2F9)

ING1 Antibody (2F9)

Product Information

Product Overview:

This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Application:

Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Catalog#: H00003621-M05
LID#: 171748A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesMouse
SpeciesHuman
Entrez Human ID3621
LocalizationNuclear
NotesThis product is produced by and distributed for Abnova, a company based in Taiwan.
PreservationNo Preservative
Species ReactivityHuman. Other species not tested.
Swissprot Human IDNP_937862
Gene SymbolING1
ApplicationsWB, ELISA, S-ELISA
Species AbbreviationHu
Grade/PurityIgG purified
Clone2F9
ClonalityMonoclonal
ImmunogenING1 (NP_937862, 41 a.a. ~ 141 a.a) partial recombinant protein with GST tag.DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQ ELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAG NSGKAGADRPKGEAAA
SpecificityING1 - inhibitor of growth family, member 1
IsotypeIgG IgA IgM Mix Kappa
Storage BufferPhosphate buffered saline, pH 7.2
DilutionSandwich ELISA, ELISA, Western Blot 1:500
Gene ID9212
Unit Size0.05mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonymgrowth inhibitor ING1, growth inhibitory protein ING1, inhibitor of growth family, member 1, inhibitor of growth protein 1, p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a, tumor suppressor ING1

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals