IMPG2 Antibody

IMPG2 Antibody

Product Information

Product Overview:

Interphotoreceptor matrix proteoglycan-2 (IMPG2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in th e fundus of the eye.Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.[supplied by OMIM].


This is a rabbit polyclonal antibody against IMPG2 and was validated on Western blot.

Catalog#: NBP1-62656
LID#: 171603A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
Entrez Human ID50939
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Guinea pig: 92%
Swissprot Human IDQ9BZV3
Gene SymbolIMPG2
Species AbbreviationHu, Mu, Rt, Bv, Ca, Eq, GP
Grade/PurityPeptide affinity purified
ImmunogenSynthetic peptides corresponding to IMPG2(interphotoreceptor matrix proteoglycan 2) The peptide sequence was selected from the C terminal of IMPG2. Peptide sequence VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:100-1:2000
Unit Size0.05 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
Synonyminterphotoreceptor matrix proteoglycan 2, interphotoreceptor matrix proteoglycan 200, Interphotoreceptor matrix proteoglycan of 200 kDa, IPM 200, IPM200SPACRCAN, RP56, Sialoprotein associated with cones and rods proteoglycan, Spacrcan

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals