IMMP2L Antibody

IMMP2L Antibody

Product Information

Product Overview:

See detailed product specifications below.


This is a rabbit polyclonal antibody against IMMP2L and was validated on Western blot.

Catalog#: NBP1-79838
LID#: 171555A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Guinea Pig, Zebrafish
Entrez Human ID83943
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Chicken: 92%; Zebrafish: 92%
Swissprot Human IDNP_115938
Gene SymbolIMMP2L
Species AbbreviationHu, GP, Ze
Grade/PurityPeptide affinity purified
ImmunogenSynthetic peptide directed towards the N terminal of human IMMP2LThe immunogen for this antibody is IMMP2L. Peptide sequence LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 1:1000
Unit Size0.05 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymEC 3.4.21.-, EC 3.4.21, IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae), IMP2 inner mitochondrial membrane protease-like (S. cerevisiae), IMP2inner mitochondrial membrane peptidase 2 like, IMP2-LIKE, IMP2-like protein, mitochondrial inner membrane protease subunit 2

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals