ILF3 Antibody

ILF3 Antibody

Product Information

Product Overview:

ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity. ILF3 may regulate transcription of the IL2 gene during T-cell activation. It can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.


This is a rabbit polyclonal antibody against ILF3 and was validated on Western Blot and immunohistochemistry-paraffin

Catalog#: NBP1-58226
LID#: 171540A
Quantity :
Order by Phone or Fax: 1.800.316.3081


Host SpeciesRabbit
SpeciesHuman, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit
Entrez Human ID3609
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Human: 100%; Equine: 92%; Bovine: 85%; Canine: 85%; Rabbit: 85%; Guinea pig: 78%; Mouse: 78%; Pig: 78%; Rat: 78%
Swissprot Human IDQ12906-2
Gene SymbolILF3
ApplicationsWB, IHC, IHC-P
Species AbbreviationHu, Mu, Rt, Bv, Ca, Eq, GP, Po, Rb
Grade/PurityPeptide affinity purified
ImmunogenSynthetic peptides corresponding to ILF3 (interleukin enhancer binding factor 3, 90kDa) The peptide sequence was selected from the N terminal of ILF3 . Peptide sequence ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionImmunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:10-1:2000, Western Blot 1:100-1:2000
Unit Size0.05 mg
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymDRBF, DRBP76M-phase phosphoprotein 4, Double-stranded RNA-binding protein 76, double-stranded RNA-binding protein, 76 kD, dsRNA binding protein NFAR-2/MPP4, interleukin enhancer binding factor 3, 90kDa, interleukin enhancer-binding factor 3, MPP4MMP4, MPHOSPH4interleukin enhancer binding factor 3, 90kD, NF90CBTF, NFAR-1, NFAR2, NFARNF110, NF-AT-90, Nuclear factor of activated T-cells 90 kDa, nuclear factor of activated T-cells, 90 kD, Nuclear factor associated with dsRNA, TCP110, TCP80, Translational control protein 80

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No


Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals