B3GAT2 Antibody

B3GAT2 Antibody

Product Information

Product Overview:

B3gat2 is involved in the biosynthesis of L2/HNK-1 carbohydrate epitope on both glycolipids and glycoproteins.

Application:

This is a rabbit polyclonal antibody against B3gat2 and was validated on Western blot.

Catalog#: NBP1-68910
LID#: 171752A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman, Mouse, Bovine, Equine, Guinea Pig, Porcine, Rabbit
Entrez Human ID135152
NotesThe addition of 50% glycerol is recommended for those storing this antibody at -20C. However, please note that glycerol may interrupt some downstream antibody applications.
PreservationNo Preservative
Species ReactivityExpected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Guinea pig: 92%; Pig: 92%; Rabbit: 92%
Gene SymbolB3GAT2
ApplicationsWB
Species AbbreviationHu, Mu, Bv, Eq, GP, Po, Rb
Grade/PurityPeptide affinity purified
ClonalityPolyclonal
ImmunogenSynthetic peptides corresponding to B3gat2 (beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)) The peptide sequence was selected from the C terminal of B3gat2. Peptide sequence SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV.
Storage BufferPBS & 2% Sucrose lyophilized with the antibody.
DilutionWestern Blot 0.2-1 ug/ml
Unit Size0.05 mg
ConcentrationLYOPH
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymBeta-1,3-glucuronyltransferase 2, beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S), EC 2.4.1.135, GlcAT-D, GlcAT-S, GLCATSgalactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2, Glucuronosyltransferase S, KIAA1963glcAT-D, MGC138535, UDP-glucuronosyltransferase S, UDP-glucuronyltransferase S, uridine diphosphate glucuronic acid:acceptor glucuronosyltransferase

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at -20C. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals