AXUD1 Antibody

AXUD1 Antibody

Product Information

Product Overview:

See detailed product specifications below.

Catalog#: NBP1-91692
LID#: 171543A
Quantity :
Order by Phone or Fax: 1.800.316.3081

Specifications

Host SpeciesRabbit
SpeciesHuman
Entrez Human ID64651
Preservation0.02% Sodium Azide
Species ReactivityHuman
Gene SymbolCSRNP1
ApplicationsWB, ICC/IF, IHC, IHC-P
Species AbbreviationHu
Grade/PurityImmunogen affinity purified
ClonalityPolyclonal
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:REGCENPMGRVEFNQARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSSDMTDSSTASSSASGT
SpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage BufferPhospate buffered saline, pH 7.2, containing 40% glycerol
DilutionWestern Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry 1:10-1:2000
Unit Size0.1 ml
Safety StatementsThis product is for research use only and is not approved for use in humans or in clinical diagnosis.
Sample AvailabilityYes
SynonymAXUD1DKFZp566F164, AXIN1 up-regulated 1, Axin-1 up-regulated gene 1 protein, CSRNP-1, cysteine-serine-rich nuclear protein 1, cysteine/serine-rich nuclear protein 1, FAM130B, Protein URAX1, TAIP3, TAIP-3TGF-beta-induced apoptosis protein 3, TGF-beta induced apoptosis protein 3, URAX1

Shipping & Handling

Estimated Ship Time: 3 Business Days

Shipped In: Blue Ice

Hazardous Material: No

Storage

Storage Temperature: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Customer Reviews

Average Customer Rating
(0)
Review & Rating Distribution

Customers Who Viewed This Item Also Viewed

Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals
Novus Biologicals